Csf2 (Rat) Recombinant Protein

October 29, 2025

Name :
Csf2 (Rat) Recombinant Protein

Biological Activity :
Rat Csf2 recombinant protein expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins

Tag :
Result of activity analysis

Protein Accession No. :
P48750

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=116630

Amino Acid Sequence :
MAPTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK

Molecular Weight :
14.6

Storage and Stability :
Store at -20°C on dry atmosphere.After reconstitution with sterilized water, store at -20°C.Aliquot to avoid repeated freezing and thawing.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :
1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue Lane 1: non-reducing conditionsLane 2: reducing conditions

Storage Buffer :
Lyophilized from 20 mM NaHCO3

Applications :
Functional Study， SDS-PAGE，

Gene Name :
Csf2

Gene Alias :
Gm-csf, Gmcsf

Gene Description :
colony stimulating factor 2 (granulocyte-macrophage)

Gene Summary :

Other Designations :
colony stimulating factor 2

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Delta-like 3 (DLL3) Recombinant Proteins
DC-SIGN/CD209 Proteinsupplier
Popular categories:
Complement Component 5a
CCR3