Name :
CD59 (Human) Recombinant Protein
Biological Activity :
Human CD59 (P13987, 26 a.a. – 102 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.
Tag :
Protein Accession No. :
P13987
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=966
Amino Acid Sequence :
MGSSHHHHHHSSGLVPRGSHMGSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN.
Molecular Weight :
11.3
Storage and Stability :
Store at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Quality Control Testing :
Storage Buffer :
20mM Tris-HCl buffer (pH 8.0), 0.15M NaCl, 1mM DTT and 10% glycerol.
Applications :
SDS-PAGE,
Gene Name :
CD59
Gene Alias :
16.3A5, 1F5, EJ16, EJ30, EL32, FLJ38134, FLJ92039, G344, HRF-20, HRF20, MAC-IP, MACIF, MEM43, MGC2354, MIC11, MIN1, MIN2, MIN3, MIRL, MSK21, p18-20
Gene Description :
CD59 molecule, complement regulatory protein
Gene Summary :
This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq
Other Designations :
20 kDa homologous restriction factor|CD59 antigen|CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344)|CD59 glycoprotein|Ly-6-like protein|T cell-activating protein|human leukocyte antigen MIC11|lymphocytic a
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-3 ProteinAccession
BTN1A1 Proteinmanufacturer
Popular categories:
IGFBP-1
Siglec-E